PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G12200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 540aa    MW: 58003.2 Da    PI: 8.4907
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G12200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.7e-38160220262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++k+l+cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGa+rnvPvG+grr+nk++s
  ORUFI01G12200.1 160 PDKILPCPRCNSMETKFCYFNNYNVHQPRHFCRNCQRYWTAGGAMRNVPVGAGRRRNKHVS 220
                      7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-31157217IPR003851Zinc finger, Dof-type
PfamPF027012.8E-31162218IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.602164218IPR003851Zinc finger, Dof-type
PROSITE patternPS013610166202IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MAMGLAALSS FGGRWLRSGR MRRRRRSFGG VAAALGGGGW LAAAALGGGG QRAGGWRVVV  60
VVGGGEDENE RRGWIGNRPR QIGIEVMPNL GNGVKTNNDL PLVSDKLLIV KGIPFCPNNS  120
KKNDLQGISR PDGRIEIDSM TEDVKTEPDG SVPEKILKKP DKILPCPRCN SMETKFCYFN  180
NYNVHQPRHF CRNCQRYWTA GGAMRNVPVG AGRRRNKHVS KYCQAMMTCN NTVAPGDVSD  240
VVHHQVITHG SSLLPATLKE NETPTEFISE VPPCKSSASI LDIGEPNDTD LVPLASGDNK  300
EEKSCASSVV VSSCSENLMP DNAIMKEPNN RSGCCNGVAL PFPTGPALVL PWSLGWNSVA  360
LMPATQCSMQ PVLGLKDGIP CPPSWPPQLM VPAPGICTPV VPIPLVPPLW SCFPGWPNGM  420
WNAQCPGGNT TVLPSTAPNK ISCSGSSSLV LGKHSREESL QEEEKTRNNL WVPKTLRIDD  480
PAEAAKSSIW ATLGIKPDDK GIFKSFQPNV AKNGTAPESP QALQANPAAF SRSQSFQETT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635234.10.0PREDICTED: cyclic dof factor 2
TrEMBLA0A0E0MUM10.0A0A0E0MUM1_ORYRU; Uncharacterized protein
STRINGBGIOSGA003252-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-61cycling DOF factor 2